PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G024100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 365aa    MW: 40396.9 Da    PI: 5.222
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G024100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.38.7e-5581371129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL +     ++e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+
  Brast02G024100.1.p   8 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLTEhcgIGYEEQSEWYFFSFKDRKYPTGTRTNRATMAGFWKATGR 97 
                         69****************************.9***************853542334667******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk+v++ +++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Brast02G024100.1.p  98 DKAVHE-RSRLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 137
                         *****9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-596157IPR003441NAC domain
PROSITE profilePS5100559.0818157IPR003441NAC domain
PfamPF023651.9E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDSMESCVPP GFRFHPTDEE LVGYYLRKKV ASQKIDLDVI RDIDLYRIEP WDLTEHCGIG  60
YEEQSEWYFF SFKDRKYPTG TRTNRATMAG FWKATGRDKA VHERSRLIGM RKTLVFYKGR  120
APNGQKTDWI MHEYRLETDE NAPPQEEGWV VCRAFKKRAA YPSRGMGMAE RWDSNYSSPY  180
HDAASAMAGS PAFADPASSY AARTARFKAE EDGAQLLRYT TSHLVELPHL ESPSAMPSAL  240
PPATKKKAKN NNNPSRRALP EEEDQDQDEA GGGGGKVTAD WRALDKFVAS QLSPGGGARL  300
DQPAAGGSSK AELERDQDQD DMAALLFLNG DERDEMERWT GLLASASGAG AGGDGDLGIC  360
VFDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-50515812169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934220.0JQ693422.1 Brachypodium distachyon SWN1 (SWN1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266879.10.0uncharacterized protein LOC100835498
RefseqXP_014755664.10.0PREDICTED: uncharacterized protein LOC100835498 isoform X1
RefseqXP_014755549.10.0PREDICTED: uncharacterized protein LOC100835498 isoform X1
SwissprotQ9SL411e-124NAC37_ARATH; NAC domain-containing protein 37
TrEMBLI2E2W10.0I2E2W1_BRADI; SWN1
STRINGMLOC_56769.11e-178(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-107vascular related NAC-domain protein 1